PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.02G269900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HB-other
Protein Properties Length: 296aa    MW: 33383.3 Da    PI: 5.9124
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.02G269900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.45.1e-082272592355
                          SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
             Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                          + + +++++ LA+++gL+ +q+ +WF N+R ++
  Glyma.02G269900.1.p 227 PSVEESQKQALAESTGLDMKQINNWFINQRKRH 259
                          6678999***********************885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.8E-1466110IPR005540KNOX1
PfamPF037904.8E-1868106IPR005540KNOX1
SMARTSM012562.2E-26119170IPR005541KNOX2
PfamPF037916.0E-22122168IPR005541KNOX2
SMARTSM003893.6E-4202266IPR001356Homeobox domain
SuperFamilySSF466891.8E-10225273IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-16226265IPR009057Homeodomain-like
CDDcd000861.64E-8227263No hitNo description
PfamPF059207.2E-10231258IPR008422Homeobox KN domain
PROSITE profilePS500719.604231262IPR001356Homeobox domain
PROSITE patternPS000270237260IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MIGFGGNSCS ELSEMDMTNM ETNRKFLSLP LSNNNNSGDN RRVPVTSNSI AQEHHYSHHH  60
NPTDTCSVRD KIMAHPLFPR LLSSYLNCLK VGAPPEVVAS LEESYAKYES FNASSGRIGG  120
GSIGEDPALD QFMEAYCEML IKYEQELTKP FKEAMLFFSR IECQLKALAV SSDFVMDRCF  180
TTMKLLEINP CGKVLVRGYV SSDESRFNLL SLVKVVVLLA CVNVFKPSVE ESQKQALAES  240
TGLDMKQINN WFINQRKRHW KPSEDMQFAV MDATNYYMEN VMCKPFPMDS MPMLL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.569510.0meristem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF5337021e-150EF533702.1 Glycine max clone BAC GM_WBb098N11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014628170.11e-160PREDICTED: homeobox protein knotted-1-like LET6
SwissprotP466081e-75HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLK7KB190.0K7KB19_SOYBN; Uncharacterized protein
STRINGGLYMA02G43761.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Representative plantOGRP16717148
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.13e-64KNOX/ELK homeobox transcription factor